CCL8/MCP-2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24871
Article Name: CCL8/MCP-2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24871
Supplier Catalog Number: A24871
Alternative Catalog Number: ABB-A24871-20UL,ABB-A24871-100UL,ABB-A24871-1000UL,ABB-A24871-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8, C-C motif chemokine 8, CCL8/MCP-2
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.
Clonality: Polyclonal
Concentration: WB
Molecular Weight: 11kDa
NCBI: 6355
UniProt: P80075
Purity: Affinity purification
Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Target: CCL8
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology & Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Chemokines,Chemokine. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and293T cells transfected withCCL8/MCP-2 usingCCL8/MCP-2 Rabbit pAb (A24871) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:180s.