CD146 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25042
Artikelname: CD146 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25042
Hersteller Artikelnummer: A25042
Alternativnummer: ABB-A25042-20UL,ABB-A25042-100UL,ABB-A25042-500UL,ABB-A25042-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CD146, MUC18, HEMCAM, METCAM, MelCAM
Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 4162
UniProt: P43121
Reinheit: Affinity purification
Sequenz: STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Target-Kategorie: MCAM
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates usingCD146 Rabbit pAb (A25042) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):COLO 205.
Exposure time:90s.