CD146 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A25042
Article Name: CD146 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A25042
Supplier Catalog Number: A25042
Alternative Catalog Number: ABB-A25042-20UL,ABB-A25042-100UL,ABB-A25042-500UL,ABB-A25042-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD146, MUC18, HEMCAM, METCAM, MelCAM
Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 4162
UniProt: P43121
Purity: Affinity purification
Sequence: STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Target: MCAM
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates usingCD146 Rabbit pAb (A25042) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):COLO 205.
Exposure time:90s.