UGT2B10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7570
- Bilder (1)
| Artikelname: | UGT2B10 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7570 |
| Hersteller Artikelnummer: | A7570 |
| Alternativnummer: | ABB-A7570-20UL,ABB-A7570-100UL,ABB-A7570-500UL,ABB-A7570-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | UDPGT2B10, UGT2B10 |
| Predicted to be involved in lipid metabolic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be integral component of membrane. Predicted to be active in intracellular membrane-bounded organelle. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 61kDa |
| NCBI: | 7365 |
| UniProt: | P36537 |
| Reinheit: | Affinity purification |
| Sequenz: | GSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVD |
| Target-Kategorie: | UGT2B10 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag |

