UGT2B10 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7570
- Images (1)
| Article Name: | UGT2B10 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7570 |
| Supplier Catalog Number: | A7570 |
| Alternative Catalog Number: | ABB-A7570-20UL,ABB-A7570-100UL,ABB-A7570-500UL,ABB-A7570-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | UDPGT2B10, UGT2B10 |
| Predicted to be involved in lipid metabolic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be integral component of membrane. Predicted to be active in intracellular membrane-bounded organelle. |
| Clonality: | Polyclonal |
| Molecular Weight: | 61kDa |
| NCBI: | 7365 |
| UniProt: | P36537 |
| Purity: | Affinity purification |
| Sequence: | GSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVD |
| Target: | UGT2B10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using UGT2B10 Rabbit pAb (A7570) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
