SGK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7586
- Bilder (1)
| Artikelname: | SGK3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7586 |
| Hersteller Artikelnummer: | A7586 |
| Alternativnummer: | ABB-A7586-100UL,ABB-A7586-20UL,ABB-A7586-1000UL,ABB-A7586-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CISK, SGK2, SGKL, SGK3 |
| This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 23678 |
| UniProt: | Q96BR1 |
| Reinheit: | Affinity purification |
| Sequenz: | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLG |
| Target-Kategorie: | SGK3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Endocrine Metabolism,Insulin Receptor Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SGK3 Rabbit pAb (A7586) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
