SGK3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7586
- Images (1)
| Article Name: | SGK3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7586 |
| Supplier Catalog Number: | A7586 |
| Alternative Catalog Number: | ABB-A7586-100UL,ABB-A7586-20UL,ABB-A7586-1000UL,ABB-A7586-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CISK, SGK2, SGKL, SGK3 |
| This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 23678 |
| UniProt: | Q96BR1 |
| Purity: | Affinity purification |
| Sequence: | MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLG |
| Target: | SGK3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Endocrine Metabolism,Insulin Receptor Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SGK3 Rabbit pAb (A7586) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 10s. |
Product Guarantee and Expert Support
