ZCWPW1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7596
- Bilder (1)
| Artikelname: | ZCWPW1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7596 |
| Hersteller Artikelnummer: | A7596 |
| Alternativnummer: | ABB-A7596-20UL,ABB-A7596-100UL,ABB-A7596-1000UL,ABB-A7596-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZCW1, ZCWPW1 |
| Enables methyl-CpG binding activity and methylated histone binding activity. Predicted to be involved in meiosis I, positive regulation of DNA metabolic process, and spermatogenesis. Predicted to act upstream of or within homologous chromosome pairing at meiosis. Predicted to be located in XY body. Predicted to be active in nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 72kDa |
| NCBI: | 55063 |
| UniProt: | Q9H0M4 |
| Reinheit: | Affinity purification |
| Sequenz: | VMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPPAPRMGRKEGQGNSDSDQPGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPV |
| Target-Kategorie: | ZCWPW1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ZCWPW1 Rabbit pAb (A7596) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
