ZCWPW1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7596
- Images (1)
| Article Name: | ZCWPW1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7596 |
| Supplier Catalog Number: | A7596 |
| Alternative Catalog Number: | ABB-A7596-20UL,ABB-A7596-100UL,ABB-A7596-1000UL,ABB-A7596-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ZCW1, ZCWPW1 |
| Enables methyl-CpG binding activity and methylated histone binding activity. Predicted to be involved in meiosis I, positive regulation of DNA metabolic process, and spermatogenesis. Predicted to act upstream of or within homologous chromosome pairing at meiosis. Predicted to be located in XY body. Predicted to be active in nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 72kDa |
| NCBI: | 55063 |
| UniProt: | Q9H0M4 |
| Purity: | Affinity purification |
| Sequence: | VMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPPAPRMGRKEGQGNSDSDQPGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPV |
| Target: | ZCWPW1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ZCWPW1 Rabbit pAb (A7596) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
