CACNB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7649
- Bilder (1)
| Artikelname: | CACNB1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7649 |
| Hersteller Artikelnummer: | A7649 |
| Alternativnummer: | ABB-A7649-20UL,ABB-A7649-100UL,ABB-A7649-1000UL,ABB-A7649-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAB1, CCHLB1, CACNLB1, CACNB1 |
| The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 66kDa |
| NCBI: | 782 |
| UniProt: | Q02641 |
| Reinheit: | Affinity purification |
| Sequenz: | ATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR |
| Target-Kategorie: | CACNB1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Neuroscience,Calcium Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HepG2 cells, using CACNB1 Rabbit pAb (A7649) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
