CACNB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7649
Article Name: CACNB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7649
Supplier Catalog Number: A7649
Alternative Catalog Number: ABB-A7649-20UL,ABB-A7649-100UL,ABB-A7649-1000UL,ABB-A7649-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAB1, CCHLB1, CACNLB1, CACNB1
The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 782
UniProt: Q02641
Purity: Affinity purification
Sequence: ATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Target: CACNB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using CACNB1 Rabbit pAb (A7649) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.