EGR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7669
- Bilder (1)
| Artikelname: | EGR3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7669 |
| Hersteller Artikelnummer: | A7669 |
| Alternativnummer: | ABB-A7669-100UL,ABB-A7669-20UL,ABB-A7669-1000UL,ABB-A7669-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EGR-3, PILOT, EGR3 |
| This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also play a role in a wide variety of processes including muscle development, lymphocyte development, endothelial cell growth and migration, and neuronal development. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 43 kDa |
| NCBI: | 1960 |
| UniProt: | Q06889 |
| Reinheit: | Affinity purification |
| Sequenz: | MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPP |
| Target-Kategorie: | EGR3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from SKOV3 cells, using EGR3 Rabbit pAb (A7669) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
