EGR3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7669
- Images (1)
| Article Name: | EGR3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7669 |
| Supplier Catalog Number: | A7669 |
| Alternative Catalog Number: | ABB-A7669-100UL,ABB-A7669-20UL,ABB-A7669-1000UL,ABB-A7669-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EGR-3, PILOT, EGR3 |
| This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also play a role in a wide variety of processes including muscle development, lymphocyte development, endothelial cell growth and migration, and neuronal development. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 43 kDa |
| NCBI: | 1960 |
| UniProt: | Q06889 |
| Purity: | Affinity purification |
| Sequence: | MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPP |
| Target: | EGR3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from SKOV3 cells, using EGR3 Rabbit pAb (A7669) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Product Guarantee and Expert Support
