FGF6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7672
Artikelname: FGF6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7672
Hersteller Artikelnummer: A7672
Alternativnummer: ABB-A7672-100UL,ABB-A7672-20UL,ABB-A7672-500UL,ABB-A7672-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HST2, HBGF-6, FGF6
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene displayed oncogenic transforming activity when transfected into mammalian cells. The mouse homolog of this gene exhibits a restricted expression profile predominantly in the myogenic lineage, which suggested a role in muscle regeneration or differentiation.
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 2251
UniProt: P10767
Reinheit: Affinity purification
Sequenz: MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQV
Target-Kategorie: FGF6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of lysates from Rat skeletal muscle, using FGF6 Rabbit pAb (A7672) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.