FGF6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7672
Article Name: FGF6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7672
Supplier Catalog Number: A7672
Alternative Catalog Number: ABB-A7672-100UL,ABB-A7672-20UL,ABB-A7672-500UL,ABB-A7672-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HST2, HBGF-6, FGF6
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene displayed oncogenic transforming activity when transfected into mammalian cells. The mouse homolog of this gene exhibits a restricted expression profile predominantly in the myogenic lineage, which suggested a role in muscle regeneration or differentiation.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 2251
UniProt: P10767
Purity: Affinity purification
Sequence: MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQV
Target: FGF6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of lysates from Rat skeletal muscle, using FGF6 Rabbit pAb (A7672) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.