SCN2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7723
- Bilder (1)
| Artikelname: | SCN2B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7723 |
| Hersteller Artikelnummer: | A7723 |
| Alternativnummer: | ABB-A7723-100UL,ABB-A7723-20UL,ABB-A7723-500UL,ABB-A7723-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATFB14, SCN2B |
| The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 24kDa |
| NCBI: | 6327 |
| UniProt: | O60939 |
| Reinheit: | Affinity purification |
| Sequenz: | MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV |
| Target-Kategorie: | SCN2B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SCN2B Rabbit pAb (A7723) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
