SCN2B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7723
Article Name: SCN2B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7723
Supplier Catalog Number: A7723
Alternative Catalog Number: ABB-A7723-100UL,ABB-A7723-20UL,ABB-A7723-500UL,ABB-A7723-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATFB14, SCN2B
The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 6327
UniProt: O60939
Purity: Affinity purification
Sequence: MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV
Target: SCN2B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using SCN2B Rabbit pAb (A7723) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.