SSX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7732
- Bilder (1)
| Artikelname: | SSX5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7732 |
| Hersteller Artikelnummer: | A7732 |
| Alternativnummer: | ABB-A7732-20UL,ABB-A7732-100UL,ABB-A7732-1000UL,ABB-A7732-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SSX5 |
| The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X,18)(p11.2,q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 22kDa |
| NCBI: | 6758 |
| UniProt: | O60225 |
| Reinheit: | Affinity purification |
| Sequenz: | MNGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEARAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE |
| Target-Kategorie: | SSX5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Immunology Inflammation. Shipping: Ice Bag |

