SSX5 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7732
- Images (1)
| Article Name: | SSX5 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7732 |
| Supplier Catalog Number: | A7732 |
| Alternative Catalog Number: | ABB-A7732-20UL,ABB-A7732-100UL,ABB-A7732-1000UL,ABB-A7732-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | SSX5 |
| The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X,18)(p11.2,q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 22kDa |
| NCBI: | 6758 |
| UniProt: | O60225 |
| Purity: | Affinity purification |
| Sequence: | MNGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEARAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE |
| Target: | SSX5 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat liver, using SSX5 Rabbit pAb (A7732) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
