TRPC3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7742
Artikelname: TRPC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7742
Hersteller Artikelnummer: A7742
Alternativnummer: ABB-A7742-100UL,ABB-A7742-20UL,ABB-A7742-500UL,ABB-A7742-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TRP3, SCA41, TRPC3
The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 106kDa
NCBI: 7222
UniProt: Q13507
Reinheit: Affinity purification
Sequenz: FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
Target-Kategorie: TRPC3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag
Western blot analysis of various lysates using TRPC3 Rabbit pAb (A7742) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.