TRPC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7742
Article Name: TRPC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7742
Supplier Catalog Number: A7742
Alternative Catalog Number: ABB-A7742-100UL,ABB-A7742-20UL,ABB-A7742-500UL,ABB-A7742-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TRP3, SCA41, TRPC3
The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 7222
UniProt: Q13507
Purity: Affinity purification
Sequence: FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
Target: TRPC3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag
Western blot analysis of various lysates using TRPC3 Rabbit pAb (A7742) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.