ST8SIA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7748
- Bilder (1)
| Artikelname: | ST8SIA2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7748 |
| Hersteller Artikelnummer: | A7748 |
| Alternativnummer: | ABB-A7748-20UL,ABB-A7748-100UL,ABB-A7748-500UL,ABB-A7748-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | STX, SIAT8B, SIAT8-B, HsT19690, ST8SiaII, ST8SIA-II, ST8SIA2 |
| The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42kDa |
| NCBI: | 8128 |
| UniProt: | Q92186 |
| Reinheit: | Affinity purification |
| Sequenz: | DISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIV |
| Target-Kategorie: | ST8SIA2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ST8SIA2 Rabbit pAb (A7748) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
