ST8SIA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7748
Article Name: ST8SIA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7748
Supplier Catalog Number: A7748
Alternative Catalog Number: ABB-A7748-20UL,ABB-A7748-100UL,ABB-A7748-500UL,ABB-A7748-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: STX, SIAT8B, SIAT8-B, HsT19690, ST8SiaII, ST8SIA-II, ST8SIA2
The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 8128
UniProt: Q92186
Purity: Affinity purification
Sequence: DISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIV
Target: ST8SIA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ST8SIA2 Rabbit pAb (A7748) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.