CPLX2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7774
- Bilder (1)
| Artikelname: | CPLX2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7774 |
| Hersteller Artikelnummer: | A7774 |
| Alternativnummer: | ABB-A7774-100UL,ABB-A7774-20UL,ABB-A7774-1000UL,ABB-A7774-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CPX2, Hfb1, 921-L, CPX-2, CPLX2 |
| Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 15kDa |
| NCBI: | 10814 |
| UniProt: | Q6PUV4 |
| Reinheit: | Affinity purification |
| Sequenz: | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK |
| Target-Kategorie: | CPLX2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CPLX2 Rabbit pAb (A7774) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
