CPLX2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7774
Article Name: CPLX2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7774
Supplier Catalog Number: A7774
Alternative Catalog Number: ABB-A7774-100UL,ABB-A7774-20UL,ABB-A7774-1000UL,ABB-A7774-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CPX2, Hfb1, 921-L, CPX-2, CPLX2
Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 10814
UniProt: Q6PUV4
Purity: Affinity purification
Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Target: CPLX2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using CPLX2 Rabbit pAb (A7774) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.