STARD3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7776
- Bilder (1)
| Artikelname: | STARD3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7776 |
| Hersteller Artikelnummer: | A7776 |
| Alternativnummer: | ABB-A7776-20UL,ABB-A7776-100UL,ABB-A7776-500UL,ABB-A7776-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAB1, es64, MLN64, STARD3 |
| This gene encodes a member of a subfamily of lipid trafficking proteins that are characterized by a C-terminal steroidogenic acute regulatory domain and an N-terminal metastatic lymph node 64 domain. The encoded protein localizes to the membranes of late endosomes and may be involved in exporting cholesterol. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 51kDa |
| NCBI: | 10948 |
| UniProt: | Q14849 |
| Reinheit: | Affinity purification |
| Sequenz: | DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLA |
| Target-Kategorie: | STARD3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STARD3 Rabbit pAb (A7776) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
