STARD3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7776
- Images (1)
| Article Name: | STARD3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7776 |
| Supplier Catalog Number: | A7776 |
| Alternative Catalog Number: | ABB-A7776-20UL,ABB-A7776-100UL,ABB-A7776-500UL,ABB-A7776-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CAB1, es64, MLN64, STARD3 |
| This gene encodes a member of a subfamily of lipid trafficking proteins that are characterized by a C-terminal steroidogenic acute regulatory domain and an N-terminal metastatic lymph node 64 domain. The encoded protein localizes to the membranes of late endosomes and may be involved in exporting cholesterol. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 51kDa |
| NCBI: | 10948 |
| UniProt: | Q14849 |
| Purity: | Affinity purification |
| Sequence: | DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLA |
| Target: | STARD3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STARD3 Rabbit pAb (A7776) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
