CBLC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7789
- Bilder (1)
| Artikelname: | CBLC Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7789 |
| Hersteller Artikelnummer: | A7789 |
| Alternativnummer: | ABB-A7789-100UL,ABB-A7789-20UL,ABB-A7789-1000UL,ABB-A7789-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CBL-3, RNF57, CBL-SL, CBLC |
| This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 23624 |
| UniProt: | Q9ULV8 |
| Reinheit: | Affinity purification |
| Sequenz: | DEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA |
| Target-Kategorie: | CBLC |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CBLC Rabbit pAb (A7789) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 90s. |
Produktgarantie und fachkundiger Support
