CBLC Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7789
Article Name: CBLC Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7789
Supplier Catalog Number: A7789
Alternative Catalog Number: ABB-A7789-100UL,ABB-A7789-20UL,ABB-A7789-1000UL,ABB-A7789-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CBL-3, RNF57, CBL-SL, CBLC
This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 23624
UniProt: Q9ULV8
Purity: Affinity purification
Sequence: DEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
Target: CBLC
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CBLC Rabbit pAb (A7789) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 90s.