GABARAPL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7790
Artikelname: GABARAPL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7790
Hersteller Artikelnummer: A7790
Alternativnummer: ABB-A7790-20UL,ABB-A7790-100UL,ABB-A7790-1000UL,ABB-A7790-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ATG8, GEC1, APG8L, ATG8B, ATG8L, APG8-LIKE, GABARAPL1
Enables Tat protein binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in autophagosome assembly, autophagy of mitochondrion, and cellular response to nitrogen starvation. Located in autophagosome. Colocalizes with mitochondrion.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 23710
UniProt: Q9H0R8
Reinheit: Affinity purification
Sequenz: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
Target-Kategorie: GABARAPL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using GABARAPL1 Rabbit pAb (A7790) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.