GABARAPL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7790
Article Name: GABARAPL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7790
Supplier Catalog Number: A7790
Alternative Catalog Number: ABB-A7790-20UL,ABB-A7790-100UL,ABB-A7790-1000UL,ABB-A7790-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATG8, GEC1, APG8L, ATG8B, ATG8L, APG8-LIKE, GABARAPL1
Enables Tat protein binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in autophagosome assembly, autophagy of mitochondrion, and cellular response to nitrogen starvation. Located in autophagosome. Colocalizes with mitochondrion.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 23710
UniProt: Q9H0R8
Purity: Affinity purification
Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
Target: GABARAPL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using GABARAPL1 Rabbit pAb (A7790) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.