TNNI3K Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7802
Artikelname: TNNI3K Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7802
Hersteller Artikelnummer: A7802
Alternativnummer: ABB-A7802-20UL,ABB-A7802-100UL,ABB-A7802-500UL,ABB-A7802-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CARK, CCDD, TNNI3K
This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology.
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 51086
UniProt: Q59H18
Reinheit: Affinity purification
Sequenz: MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCC
Target-Kategorie: TNNI3K
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of various lysates using TNNI3K Rabbit pAb (A7802) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.