TNNI3K Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7802
Article Name: TNNI3K Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7802
Supplier Catalog Number: A7802
Alternative Catalog Number: ABB-A7802-20UL,ABB-A7802-100UL,ABB-A7802-500UL,ABB-A7802-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CARK, CCDD, TNNI3K
This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology.
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 51086
UniProt: Q59H18
Purity: Affinity purification
Sequence: MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCC
Target: TNNI3K
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of various lysates using TNNI3K Rabbit pAb (A7802) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.