ZNF350 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7829
- Bilder (1)
| Artikelname: | ZNF350 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7829 |
| Hersteller Artikelnummer: | A7829 |
| Alternativnummer: | ABB-A7829-20UL,ABB-A7829-100UL,ABB-A7829-500UL,ABB-A7829-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZFQR, ZBRK1, ZNF350 |
| Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding activity. Involved in negative regulation of transcription by RNA polymerase II. Located in nuclear body. Part of transcription repressor complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 60kDa |
| NCBI: | 59348 |
| UniProt: | Q9GZX5 |
| Reinheit: | Affinity purification |
| Sequenz: | TGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP |
| Target-Kategorie: | ZNF350 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Jurkat cells, using ZNF350 Rabbit pAb (A7829) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
