ZNF350 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7829
- Images (1)
| Article Name: | ZNF350 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7829 |
| Supplier Catalog Number: | A7829 |
| Alternative Catalog Number: | ABB-A7829-20UL,ABB-A7829-100UL,ABB-A7829-500UL,ABB-A7829-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ZFQR, ZBRK1, ZNF350 |
| Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding activity. Involved in negative regulation of transcription by RNA polymerase II. Located in nuclear body. Part of transcription repressor complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 60kDa |
| NCBI: | 59348 |
| UniProt: | Q9GZX5 |
| Purity: | Affinity purification |
| Sequence: | TGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP |
| Target: | ZNF350 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Jurkat cells, using ZNF350 Rabbit pAb (A7829) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Product Guarantee and Expert Support
