GLYCTK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7852
- Bilder (1)
| Artikelname: | GLYCTK Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7852 |
| Hersteller Artikelnummer: | A7852 |
| Alternativnummer: | ABB-A7852-100UL,ABB-A7852-20UL,ABB-A7852-1000UL,ABB-A7852-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HBEBP2, HBEBP4, HBeAgBP4A, GLYCTK |
| This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 55kDa |
| NCBI: | 132158 |
| UniProt: | Q8IVS8 |
| Reinheit: | Affinity purification |
| Sequenz: | VKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR |
| Target-Kategorie: | GLYCTK |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |

