GLYCTK Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7852
- Images (1)
| Article Name: | GLYCTK Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7852 |
| Supplier Catalog Number: | A7852 |
| Alternative Catalog Number: | ABB-A7852-100UL,ABB-A7852-20UL,ABB-A7852-1000UL,ABB-A7852-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | HBEBP2, HBEBP4, HBeAgBP4A, GLYCTK |
| This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 55kDa |
| NCBI: | 132158 |
| UniProt: | Q8IVS8 |
| Purity: | Affinity purification |
| Sequence: | VKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR |
| Target: | GLYCTK |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GLYCTK Rabbit pAb (A7852) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
