TMEM184A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7857
Artikelname: TMEM184A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7857
Hersteller Artikelnummer: A7857
Alternativnummer: ABB-A7857-100UL,ABB-A7857-20UL,ABB-A7857-500UL,ABB-A7857-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SDMG1, TMEM184A
Predicted to enable heparin binding activity. Predicted to act upstream of or within germ-line sex determination, regulation of protein localization, and regulation of secretion. Predicted to be located in cytoplasmic vesicle, perinuclear region of cytoplasm, and plasma membrane. Predicted to be active in early endosome membrane. Predicted to be integral component of membrane.
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 202915
UniProt: Q6ZMB5
Reinheit: Affinity purification
Sequenz: FPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL
Target-Kategorie: TMEM184A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using TMEM184A Rabbit pAb (A7857) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.