TMEM184A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7857
Article Name: TMEM184A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7857
Supplier Catalog Number: A7857
Alternative Catalog Number: ABB-A7857-100UL,ABB-A7857-20UL,ABB-A7857-500UL,ABB-A7857-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SDMG1, TMEM184A
Predicted to enable heparin binding activity. Predicted to act upstream of or within germ-line sex determination, regulation of protein localization, and regulation of secretion. Predicted to be located in cytoplasmic vesicle, perinuclear region of cytoplasm, and plasma membrane. Predicted to be active in early endosome membrane. Predicted to be integral component of membrane.
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 202915
UniProt: Q6ZMB5
Purity: Affinity purification
Sequence: FPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL
Target: TMEM184A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using TMEM184A Rabbit pAb (A7857) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.