FCGR3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7894
- Bilder (1)
| Artikelname: | FCGR3B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7894 |
| Hersteller Artikelnummer: | A7894 |
| Alternativnummer: | ABB-A7894-20UL,ABB-A7894-100UL,ABB-A7894-500UL,ABB-A7894-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD16, FCG3, CD16A, CD16b, FCGR3, CD16-I, FCGR3A, FCR-10, FCRIII, FCRIIIb, FCGR3B |
| The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 26kDa |
| NCBI: | 2215 |
| UniProt: | O75015 |
| Reinheit: | Affinity purification |
| Sequenz: | MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI |
| Target-Kategorie: | FCGR3B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FCGR3B Rabbit pAb (A7894) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s. |
Produktgarantie und fachkundiger Support
