FCGR3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7894
Article Name: FCGR3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7894
Supplier Catalog Number: A7894
Alternative Catalog Number: ABB-A7894-20UL,ABB-A7894-100UL,ABB-A7894-500UL,ABB-A7894-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD16, FCG3, CD16A, CD16b, FCGR3, CD16-I, FCGR3A, FCR-10, FCRIII, FCRIIIb, FCGR3B
The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1.
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 2215
UniProt: O75015
Purity: Affinity purification
Sequence: MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Target: FCGR3B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using FCGR3B Rabbit pAb (A7894) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.