ATG9A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7994
Artikelname: ATG9A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7994
Hersteller Artikelnummer: A7994
Alternativnummer: ABB-A7994-20UL,ABB-A7994-100UL,ABB-A7994-1000UL,ABB-A7994-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: mATG9, APG9L1, MGD3208, ATG9A
Acts upstream of or within autophagosome assembly. Located in endosome, phagophore assembly site, and trans-Golgi network.
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 79065
UniProt: Q7Z3C6
Reinheit: Affinity purification
Sequenz: WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI
Target-Kategorie: ATG9A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using ATG9A Rabbit pAb (A7994) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.