ATG9A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7994
| Article Name: |
ATG9A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
ABB-A7994 |
| Supplier Catalog Number: |
A7994 |
| Alternative Catalog Number: |
ABB-A7994-20UL,ABB-A7994-100UL,ABB-A7994-1000UL,ABB-A7994-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
mATG9, APG9L1, MGD3208, ATG9A |
| Acts upstream of or within autophagosome assembly. Located in endosome, phagophore assembly site, and trans-Golgi network. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
94kDa |
| NCBI: |
79065 |
| UniProt: |
Q7Z3C6 |
| Purity: |
Affinity purification |
| Sequence: |
WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI |
| Target: |
ATG9A |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Heart. Shipping: Ice Bag |
|
Western blot analysis of lysates from Mouse liver, using ATG9A Rabbit pAb (A7994) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 5s. |