ATG9A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7994
Article Name: ATG9A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7994
Supplier Catalog Number: A7994
Alternative Catalog Number: ABB-A7994-20UL,ABB-A7994-100UL,ABB-A7994-1000UL,ABB-A7994-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: mATG9, APG9L1, MGD3208, ATG9A
Acts upstream of or within autophagosome assembly. Located in endosome, phagophore assembly site, and trans-Golgi network.
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 79065
UniProt: Q7Z3C6
Purity: Affinity purification
Sequence: WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI
Target: ATG9A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using ATG9A Rabbit pAb (A7994) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.