SOCS4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8003
Artikelname: SOCS4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8003
Hersteller Artikelnummer: A8003
Alternativnummer: ABB-A8003-100UL,ABB-A8003-20UL,ABB-A8003-500UL,ABB-A8003-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SOCS7, SOCS4
The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 122809
UniProt: Q8WXH5
Reinheit: Affinity purification
Sequenz: HNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC
Target-Kategorie: SOCS4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates, using SOCS4 Rabbit pAb (A8003) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.