SOCS4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8003
Article Name: SOCS4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8003
Supplier Catalog Number: A8003
Alternative Catalog Number: ABB-A8003-100UL,ABB-A8003-20UL,ABB-A8003-500UL,ABB-A8003-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SOCS7, SOCS4
The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 122809
UniProt: Q8WXH5
Purity: Affinity purification
Sequence: HNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC
Target: SOCS4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates, using SOCS4 Rabbit pAb (A8003) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.