MED24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8059
- Bilder (1)
| Artikelname: | MED24 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8059 |
| Hersteller Artikelnummer: | A8059 |
| Alternativnummer: | ABB-A8059-20UL,ABB-A8059-100UL,ABB-A8059-1000UL,ABB-A8059-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MED5, CRSP4, ARC100, THRAP4, CRSP100, DRIP100, TRAP100, MED24 |
| This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 110kDa |
| NCBI: | 9862 |
| UniProt: | O75448 |
| Reinheit: | Affinity purification |
| Sequenz: | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAM |
| Target-Kategorie: | MED24 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MED24 Rabbit pAb (A8059) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Produktgarantie und fachkundiger Support
