MED24 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8059
- Images (1)
| Article Name: | MED24 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8059 |
| Supplier Catalog Number: | A8059 |
| Alternative Catalog Number: | ABB-A8059-20UL,ABB-A8059-100UL,ABB-A8059-1000UL,ABB-A8059-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MED5, CRSP4, ARC100, THRAP4, CRSP100, DRIP100, TRAP100, MED24 |
| This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 110kDa |
| NCBI: | 9862 |
| UniProt: | O75448 |
| Purity: | Affinity purification |
| Sequence: | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAM |
| Target: | MED24 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MED24 Rabbit pAb (A8059) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Product Guarantee and Expert Support
