LEPREL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8068
- Bilder (1)
| Artikelname: | LEPREL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8068 |
| Hersteller Artikelnummer: | A8068 |
| Alternativnummer: | ABB-A8068-100UL,ABB-A8068-20UL,ABB-A8068-1000UL,ABB-A8068-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MCVD, MLAT4, LEPREL1 |
| This gene encodes a member of the prolyl 3-hydroxylase subfamily of 2-oxo-glutarate-dependent dioxygenases. These enzymes play a critical role in collagen chain assembly, stability and cross-linking by catalyzing post-translational 3-hydroxylation of proline residues. Mutations in this gene are associated with nonsyndromic severe myopia with cataract and vitreoretinal degeneration, and downregulation of this gene may play a role in breast cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 81kDa |
| NCBI: | 55214 |
| UniProt: | Q8IVL5 |
| Reinheit: | Affinity purification |
| Sequenz: | IRYGGRQDENRVPSGVNVEGAEVHGFSMGKKLSPKIDRDLREGGPLLYENITFVYNSEQLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFEGATVLKALKSGYEGRVPLKSARLFYDISEKARRIVESYFMLNSTLYFSYTHMVCRTALSGQQDRRNDLSHPIHADNCLLDPEANECWKEPPAYTFRDYSALLYMNDDFEGGEFIFTEMDAKTVTASIKPKCGRMISFSSGGENPHGV |
| Target-Kategorie: | P3H2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from NCI-H460 cells, using LEPREL1 Rabbit pAb (A8068) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
