LEPREL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8068
Article Name: LEPREL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8068
Supplier Catalog Number: A8068
Alternative Catalog Number: ABB-A8068-100UL,ABB-A8068-20UL,ABB-A8068-1000UL,ABB-A8068-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MCVD, MLAT4, LEPREL1
This gene encodes a member of the prolyl 3-hydroxylase subfamily of 2-oxo-glutarate-dependent dioxygenases. These enzymes play a critical role in collagen chain assembly, stability and cross-linking by catalyzing post-translational 3-hydroxylation of proline residues. Mutations in this gene are associated with nonsyndromic severe myopia with cataract and vitreoretinal degeneration, and downregulation of this gene may play a role in breast cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 55214
UniProt: Q8IVL5
Purity: Affinity purification
Sequence: IRYGGRQDENRVPSGVNVEGAEVHGFSMGKKLSPKIDRDLREGGPLLYENITFVYNSEQLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFEGATVLKALKSGYEGRVPLKSARLFYDISEKARRIVESYFMLNSTLYFSYTHMVCRTALSGQQDRRNDLSHPIHADNCLLDPEANECWKEPPAYTFRDYSALLYMNDDFEGGEFIFTEMDAKTVTASIKPKCGRMISFSSGGENPHGV
Target: P3H2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from NCI-H460 cells, using LEPREL1 Rabbit pAb (A8068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.