SERPINA12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8074
- Bilder (1)
| Artikelname: | SERPINA12 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8074 |
| Hersteller Artikelnummer: | A8074 |
| Alternativnummer: | ABB-A8074-100UL,ABB-A8074-20UL,ABB-A8074-1000UL,ABB-A8074-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OL-64, SERPINA12 |
| Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within negative regulation of gluconeogenesis, positive regulation of signal transduction, and regulation of lipid metabolic process. Predicted to be located in plasma membrane. Predicted to be active in extracellular space. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 47kDa |
| NCBI: | 145264 |
| UniProt: | Q8IW75 |
| Reinheit: | Affinity purification |
| Sequenz: | LLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFIL |
| Target-Kategorie: | SERPINA12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Growth factors,Ubiquitin,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Neuroscience,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse brain, using SERPINA12 Rabbit pAb (A8074) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
